PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00582g03022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family EIL
Protein Properties Length: 550aa    MW: 61507.6 Da    PI: 5.8843
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00582g03022.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3178.37.8e-55401641128
                               XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                      EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpve 85 
                               eel++rmwkd+++lkrlker+k    +++ a++++k++++ +qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+
  Peinf101Scf00582g03022.1  40 EELERRMWKDRVKLKRLKERQKIA--AQQ-AADKQKNKQTIDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVS 121
                               8*******************9963..455.59***************************************************** PP

                               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX... CS
                      EIN3  86 gasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqte 128
                               gasd++raWWkekv+fd+ngpaai++ +    i++  +++++e
  Peinf101Scf00582g03022.1 122 GASDNIRAWWKEKVKFDKNGPAAIANDNGSSSISEAPNGSRSE 164
                               ***************************7777776655555332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.1E-5340158No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MEYCMIDADQ LGNSSDIEVD DIRCENIEDK DVSDEEIEPE ELERRMWKDR VKLKRLKERQ  60
KIAAQQAADK QKNKQTIDQA RRKKMSRAQD GILKYMLKLM EVCKARGFVY GIIPEKGKPV  120
SGASDNIRAW WKEKVKFDKN GPAAIANDNG SSSISEAPNG SRSEKKKPSV DSDSDYDVDG  180
VDVGNGSVSS RDERGNEPLD VRPLNAVPQS HQGKERRDGQ HRRRKRARSN PQQTQLSLHD  240
QQPDGGARNS LPDINNSIEQ FAGYITNGSE PESNVIGSRK HVDKNSEGRS ELPLKESNLS  300
IIPSANAVTA EDAFVGDGPS VYPIMDNSEV VPYESRFHLG SQDSIVQHQL HDTQLRNRAE  360
LSGMNNEPRN SMFHYGPPNN GLHYGPQSSA LHPDLQDSSF AHGSQFSSMH QPHIYQNYAS  420
TSEFGAAHNE QQSHLAFSGS QIKPRDSGVR SSLLHESRND IVRENHRHGK DTFQNDHDRP  480
VEMHFASPIA SGSPDYARLS SPFNFDLDVP STLDTGDFEL FLDDDVMTFF ASKLKLSQHI  540
GNGSESFLID
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788578.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2
TrEMBLM1BXC80.0M1BXC8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000768901e-176(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.18e-52ETHYLENE-INSENSITIVE3-like 3